PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_27858-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 194aa    MW: 21407.8 Da    PI: 10.7092
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_27858-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof63.92.9e-2012442860
           zf-Dof 28 qPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                     +Pr+fC+aC+ryWt+GGa+rnvPvG+grrkn+ 
  TRIUR3_27858-P1 12 KPRHFCRACHRYWTAGGAIRNVPVGSGRRKNRP 44
                     7******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088415.528144IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-101143IPR003851Zinc finger, Dof-type
PfamPF027018.8E-151243IPR003851Zinc finger, Dof-type
SuperFamilySSF577561.07E-7149184IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.101.1E-6162179IPR001878Zinc finger, CCHC-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MGGAAGIKLF GKPRHFCRAC HRYWTAGGAI RNVPVGSGRR KNRPVLHGAS TVMSVADHHL  60
AGPASPGMPN GLGFHPDHGW SQAVPPTAYL GHGEMEQCWW LVHQYPAQGQ VEIKKEHQVL  120
MVNKTTSFKK KGKGKKGNFK KNSKQVAAPG KKPKSVPKPE TECFYYKGMG HWKRNCPKYL  180
ADKKDGKVNK GDKE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130136KGKGKKG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX2955771e-118JX295577.2 Aegilops tauschii chromosome 1Ds prolamin gene locus, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM7Z4W01e-143M7Z4W0_TRIUA; Dof zinc finger protein DOF3.3
STRINGMLOC_69156.13e-59(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.15e-15Dof family protein